PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.385830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 177aa    MW: 19986.4 Da    PI: 9.031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.385830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++ ++ +G+g +W + +++ g++R++k+c++rw++yl
   Cucsa.385830.1 14 KGPWSPEEDSKLKHHIETYGTGgNWISLPQKAGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding414.6e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.385830.1  69 GEFSAEEDRIICTLFATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.671962IPR017930Myb domain
SuperFamilySSF466891.92E-2711109IPR009057Homeodomain-like
SMARTSM007171.7E-111364IPR001005SANT/Myb domain
PfamPF002491.3E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-241569IPR009057Homeodomain-like
CDDcd001671.22E-81662No hitNo description
PROSITE profilePS5129421.86963117IPR017930Myb domain
SMARTSM007171.3E-1267115IPR001005SANT/Myb domain
PfamPF002497.4E-1269111IPR001005SANT/Myb domain
CDDcd001676.58E-970113No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKHHIE TYGTGGNWIS LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FSAEEDRIIC TLFATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMMG  120
MVSSSSTANT THCAPQAEFD ELEYGGLNSN SFNNGLLFDE KMKMMQQNNN GNEGYNX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26111174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819352e-67LN681935.1 Cucumis melo genomic scaffold, unanchored_scaffold00115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657019.11e-100PREDICTED: transcription factor RAX1-like
SwissprotQ9FKL24e-75MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0H4LI123e-79A0A0H4LI12_9CARY; R2R3 type MYB15
TrEMBLK4CQL42e-79K4CQL4_SOLLC; Uncharacterized protein
STRINGSolyc09g008250.2.16e-79(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-76myb domain protein 36